PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 567aa    MW: 62841.1 Da    PI: 4.5718
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028713genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.73.3e-51261522128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  ppGfrFhPtdeelv +yLk+k+ +++l+l +vi+e+d+yk++P+dLp  + +k+++++w+fFs r +ky++g r++rat++gyWkatgkd+++++ ++
  Lus10028713  26 PPGFRFHPTDEELVLYYLKRKICRRRLRL-NVIRELDVYKWDPEDLPglALLKTGDRQWFFFSARGHKYPNGGRASRATSQGYWKATGKDRNITC-NS 121
                  8***************************9.99***************644788899***************************************.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vg+kktLvfy+grap+ge+tdWvmhey+l
  Lus10028713 122 RSVGVKKTLVFYRGRAPTGERTDWVMHEYTL 152
                  9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5919175IPR003441NAC domain
PROSITE profilePS5100554.27325175IPR003441NAC domain
PfamPF023659.3E-2726152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MLDTAVSELA GGGGGGGISA GEFKWPPGFR FHPTDEELVL YYLKRKICRR RLRLNVIREL  60
DVYKWDPEDL PGLALLKTGD RQWFFFSARG HKYPNGGRAS RATSQGYWKA TGKDRNITCN  120
SRSVGVKKTL VFYRGRAPTG ERTDWVMHEY TLDEEELKRC PNVQDYYALY KVFKKSGPGP  180
KNGEQYGAPF REEDWLDDET AIVSVPEITV RKINELPPVC NEKAVPRVEP PRDDLFDMIK  240
EIVEEPRLEP LNVTEFCPIV QVGGKEVTES TMVNSSTRDF TIPEAGYNFG NSEISELHSS  300
EAPEVNSAIK WTEDDFLEVN DLFSSEPTVM NAEQSSPTVD SLFDGIDGLS QFELYHDAAM  360
FLRDMGPLGQ ETISQSFGDN VVDHISHHQY QQSAVNEDNN ETKLHQEGDQ FDYSSWQPDQ  420
STLNELQHLL NDPQGSVLTN DAAPSNLGPQ TSGAVCDNVA NENQAASTTA EDGTSGWFSS  480
AMWNFVDSIP FEPALAAESP LVNKAMGRMT SFRRLRMNLV DANCVPVARP DIGAANARRA  540
GGKKGGLMLM LSVVAVSLAV LWVSIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-46191529140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044813.10.0PREDICTED: NAC domain-containing protein 69 isoform X1
TrEMBLB9GT490.0B9GT49_POPTR; No apical meristem family protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-113NAC domain containing protein 17